PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10435612g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 595aa    MW: 66368.2 Da    PI: 7.1818
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10435612g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.2e-18173220148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+WT+eEd++lv +++++G g+W++ +++ g+ R++k+c++rw +yl
  MA_10435612g0010 173 KGPWTPEEDQKLVTYIQEHGHGSWRALPQKAGLLRCGKSCRLRWANYL 220
                       79******************************99************97 PP

2Myb_DNA-binding52.11.5e-16226271148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  MA_10435612g0010 226 RGKFSVQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 271
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-24164223IPR009057Homeodomain-like
PROSITE profilePS5129416.172168220IPR017930Myb domain
SuperFamilySSF466898.24E-30170267IPR009057Homeodomain-like
SMARTSM007174.9E-14172222IPR001005SANT/Myb domain
PfamPF002491.6E-16173220IPR001005SANT/Myb domain
CDDcd001671.33E-10175220No hitNo description
PROSITE profilePS5129426.311221275IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-25224275IPR009057Homeodomain-like
SMARTSM007175.3E-17225273IPR001005SANT/Myb domain
PfamPF002496.8E-16226271IPR001005SANT/Myb domain
CDDcd001672.01E-11228271No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000902Biological Processcell morphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 595 aa     Download sequence    Send to blast
MERCSCISCE PWPRLACVQF KVIDIFFGVS FYRASKTRYL SLQQQALCPS VQGSKILYNE  60
ATKLVESQKN RQANAAATPH FNAFHLDQSE NCDEKKPTII SEKAHSDVQR SSHEENVELP  120
DSHHELLLPS VMLNDGNCYS ARKGERLIGS HTKPKWREIM GRAPCCEKVG LKKGPWTPEE  180
DQKLVTYIQE HGHGSWRALP QKAGLLRCGK SCRLRWANYL RPDIKRGKFS VQEEQTIIQL  240
HALLGNRWSA IATHLPKRTD NEIKNYWNTH LKKRLLQMGI DPVTHKPKSE SIIAAGVHSS  300
NGSSNLSHMA QWESARLEAE SRLARESKLR ARGLWSSPSR NVNVSSDIFS RLRRASQGFD  360
FDKEESKILG LNSVGGFDGM KITQKWDKFQ DLRSGTKLEQ CNLSPLGGSL GCYNPVENGQ  420
IEDRANQSEN CDEKKPTIVS EKAHSDVQSS SHEENVELPD SHHELLLPSV MLNDGNCSSA  480
RSDVSELTKT EQGADTSYDK VGNSDNILSE FQHIHSDEIS SSGGFKSGSS YDGFNADMLL  540
DLVVTPPNGY ATAGCGENRS LSGLSVDDNK EYWSNMFSVC NSLPNGNHSG VQSIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-261712755108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0872630.0EF087263.1 Picea sitchensis clone WS02737_G10 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9P0V41e-165A9P0V4_PICSI; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-100myb domain protein 16